Reaction Details |
| Report a problem with these data |
Target | Genome polyprotein [1027-1206,R1052K]/[1678-1691] |
---|
Ligand | BDBM3908 |
---|
Substrate/Competitor | NS4B-5A |
---|
Meas. Tech. | HCV Protease Inhibition Assay |
---|
IC50 | 340±n/a nM |
---|
Citation | Bailey, MD; Halmos, T; Goudreau, N; Lescop, E; Llinas-Brunet, M Novel azapeptide inhibitors of hepatitis C virus serine protease. J Med Chem47:3788-99 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Genome polyprotein [1027-1206,R1052K]/[1678-1691] |
---|
Name: | Genome polyprotein [1027-1206,R1052K]/[1678-1691] |
Synonyms: | HCV NS3-NS4A Serine Proteinase |
Type: | Enzyme and Cofactor |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Genome polyprotein [1027-1206,R1052K] |
Synonyms: | HCV NS3 Proteinase | NS3-NS4A Protein | POLG_HCVCO |
Type: | Enzyme Subunit |
Mol. Mass.: | 18947.03 |
Organism: | Hepatitis C virus |
Description: | HCV (BK strain) NS3 protein region from amino acid 1 to 180, harboring a C-terminal poly Lys solubilization motif (ASKKKK). |
Residue: | 180 |
Sequence: | APITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAG
SKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRG
DSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMR
|
|
|
Component 2 |
Name: | Genome polyprotein [1678-1691] |
Synonyms: | HCV NS4A | POLG_HCVJA |
Type: | Peptide |
Mol. Mass.: | 1815.28 |
Organism: | n/a |
Description: | NS4A-derived peptide |
Residue: | 17 |
Sequence: | |
BDBM3908 |
---|
NS4B-5A |
---|
Name: | NS4B-5A |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 1414.56 |
Organism: | n/a |
Description: | NS4B-5A derived peptide |
Residue: | 12 |
Sequence: | |