Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcid phosphatase (acpA)
LigandBDBM59083
Substrate/Competitorn/a
Meas. Tech.Inhibitor Screening Assay
Ki 5.9e+2± 2.3e+2 nM
Citation McRae SPagliai FAMohapatra NPGener AMahmou ASGunn JSLorca GLGonzalez CF Inhibition of AcpA phosphatase activity with ascorbate attenuates Francisella tularensis intramacrophage survival. J Biol Chem 285:5171-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acid phosphatase (acpA)
Name:Acid phosphatase (acpA)
Synonyms:Acid phosphatase (acpB) | Acid phosphatase (acpC)
Type:Enzyme
Mol. Mass.:22350.38
Organism:Francisella tularensis
Description:Q5NIC0
Residue:194
Sequence:
MTQQQVISYYESTAHENEVELILARAKKIIQAQQSLQGNAIVLDIDETALNHYYSLKLAG
FPQGENHTIWNELLSRTDAYPIKATLDFYLYCLTSGLKVFFISARFAQYLESTKQALRNA
GYVNFEDVFVFPENIEQYNSKDFKNFKAERRAYIESLGYKILISIGDQSSDLLGGYTLYT
LQLPNYLYGENSRF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM59083
n/a
NameBDBM59083
Synonyms:MLS002154065 | SMR001233380 | THONZONIUM BROMIDE | Thonzonium | cid_11102
TypeSmall organic molecule
Emp. Form.C32H55N4O
Mol. Mass.511.8048
SMILESCCCCCCCCCCCCCCCC[N+](C)(C)CCN(Cc1ccc(OC)cc1)c1ncccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: