Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-25
LigandBDBM92489
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Temperature310.15±0 K
IC50 2.5e+3± 0 nM
Citation Radichev IARemacle AGShiryaev SAPurves ANJohnson SLPellecchia MStrongin AY Biochemical characterization of the cellular glycosylphosphatidylinositol-linked membrane type-6 matrix metalloproteinase. J Biol Chem 285:16076-86 (2010) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Matrix metalloproteinase-25
Name:Matrix metalloproteinase-25
Synonyms:Leukolysin | MMP-25 | MT-MMP 6 | MT6-MMP | MT6MMP | MTMMP6 | Matrix metalloproteinase-25 | Membrane-type matrix metalloproteinase 6 | Membrane-type-6 matrix metalloproteinase | Membrane-type-6 matrix metalloproteinase (MT6-MMP)
Type:Protein
Mol. Mass.:62564.84
Organism:Homo sapiens (Human)
Description:Q9NPA2
Residue:562
Sequence:
MRLRLRLLALLLLLLAPPARAPKPSAQDVSLGVDWLTRYGYLPPPHPAQAQLQSPEKLRD
AIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPDVLGVAGLVRRRRRYALSGSVWKKRTL
TWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQ
DSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALG
LGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQ
PPASPTHSPSFPIPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFW
EGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVF
SWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKG
AHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQAA
GRWPAPIPLLLLPLLVGGVASR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM92489
n/a
NameBDBM92489
Synonyms:BI-102C8
TypeSmall organic molecule
Emp. Form.C15H15NO3
Mol. Mass.257.2845
SMILESCCOc1ccc(cc1)-c1ccccc1C(=O)NO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: