Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMethyl-accepting chemotaxis protein (McpS)
LigandBDBM26109
Substrate/Competitorn/a
Meas. Tech.Isothermal Titration Calorimetry
Temperature293.15±0 K
Kd 9.2e+4± 0 nM
Citation Lacal JAlfonso CLiu XParales REMorel BConejero-Lara FRivas GDuque ERamos JLKrell T Identification of a chemoreceptor for tricarboxylic acid cycle intermediates: differential chemotactic response towards receptor ligands. J Biol Chem 285:23126-36 (2010) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Methyl-accepting chemotaxis protein (McpS)
Name:Methyl-accepting chemotaxis protein (McpS)
Synonyms:n/a
Type:Protein
Mol. Mass.:58698.14
Organism:Pseudomonas putida (Arthrobacter siderocapsulatus)
Description:Q9Z429
Residue:538
Sequence:
MQQFTIRTRLLMLVGAMFIGFITIELMGFSALQRGVASLNTVYLDRVVPLRDLKTIADLY
AVKIVDSSHKARSGRMTYAQAEQEVKDAGRQIDMLWHAYQKTKKIDEEQRSVDALAKLVD
EAQDPIERLKGILERGDKAALDTFVENEMYPLIDPLSEGLSHLTQIQVEESKRAYDAAVV
LYDSSRTMLALLLLGILICGGVFATRLIRSIIHPLTTLKDAAARVALGDLSQSIQVSGRN
EVTDVQQSVQAMQANLRNTLQDIQGSAAQLAAAAEELQTATESTAQGIHRQNDEMQMAAT
AVTEMSAAVDEVADNANRTSNASHEAMDLADGGRKQVMLTRETIDRLSGKLNETTRTVFR
LAEEASNIGRVLDVIRAIAEQTKLLALNAAIEAAHAGEAGRGFAVVADEVRNLAQRTQTS
TQEIERMISAIQSVTQEGVRDVQQSCEFAARSQTMSSEADQALTLIAERITEINGMNLVI
ASAAEEQAQVAREVDRNLVAISDISEQSTAGVQQTSEASEELARLAANLNNLVNRFSM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26109
n/a
NameBDBM26109
Synonyms:Butyrate | butanoic acid | butanoic acid, 4
TypeSmall organic molecule
Emp. Form.C4H8O2
Mol. Mass.88.1051
SMILESCCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: