| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Matrilysin |
|---|
| Ligand | BDBM92441 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzyme Assay |
|---|
| pH | 6.8±0 |
|---|
| Temperature | 298.15±0 K |
|---|
| Ki | 626±0.0 nM |
|---|
| Citation |  Devel, L; Garcia, S; Czarny, B; Beau, F; LaJeunesse, E; Vera, L; Georgiadis, D; Stura, E; Dive, V Insights from selective non-phosphinic inhibitors of MMP-12 tailored to fit with an S1' loop canonical conformation. J Biol Chem285:35900-9 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Matrilysin |
|---|
| Name: | Matrilysin |
|---|
| Synonyms: | MMP7 | MMP7_HUMAN | MPSL1 | Matrix metalloproteinase 7 | Matrix metalloproteinase-7 (MMP-7) | Matrix metalloproteinase-7 (MMP7) | PUMP1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29681.54 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P09237 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
|
|
|
|---|
| BDBM92441 |
|---|
| n/a |
|---|
| Name | BDBM92441 |
|---|
| Synonyms: | RXP470, 1 | RXP470, Compound 4 |
|---|
| Type | Peptide |
|---|
| Emp. Form. | C35H35BrClN4O10P |
|---|
| Mol. Mass. | 818.004 |
|---|
| SMILES | NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)C(Cc1cc(no1)-c1ccc(cc1)-c1cccc(Cl)c1)CP(O)(=O)c1ccc(Br)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
