Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 125 (CYP125)
LigandBDBM31773
Substrate/Competitorn/a
Meas. Tech.Binding Assay
Kd 1.17e+4± 7e+2 nM
Citation Driscoll MDMcLean KJLevy CMast NPikuleva IALafite PRigby SELeys DMunro AW Structural and biochemical characterization of Mycobacterium tuberculosis CYP142: evidence for multiple cholesterol 27-hydroxylase activities in a human pathogen. J Biol Chem 285:38270-82 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 125 (CYP125)
Name:Cytochrome P450 125 (CYP125)
Synonyms:Cholest-4-en-3-one 26-monooxygenase | Steroid C26-monooxygenase
Type:Enzyme
Mol. Mass.:48425.01
Organism:Mycobacterium tuberculosis
Description:P9WPP0
Residue:433
Sequence:
MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPG
KGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMD
APHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIA
GLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIV
TQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPE
TAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNIL
RNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKH
WQVDYTGRCPVAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31773
n/a
NameBDBM31773
Synonyms:ECONAZOLE | Econazole nitrate | Gyno-pevaryl | Pevaryl | cid_68589
TypeSmall organic molecule
Emp. Form.C18H15Cl3N2O
Mol. Mass.381.684
SMILESClc1ccc(COC(Cn2ccnc2)c2ccc(Cl)cc2Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: