Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 144 (CYP144)
LigandBDBM31774
Substrate/Competitorn/a
Meas. Tech.Binding Assay
Kd 3.7e+2± 8e+1 nM
Citation Driscoll MDMcLean KJLevy CMast NPikuleva IALafite PRigby SELeys DMunro AW Structural and biochemical characterization of Mycobacterium tuberculosis CYP142: evidence for multiple cholesterol 27-hydroxylase activities in a human pathogen. J Biol Chem 285:38270-82 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 144 (CYP144)
Name:Cytochrome P450 144 (CYP144)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:47207.78
Organism:Mycobacterium tuberculosis
Description:P9WPL0
Residue:434
Sequence:
MRRSPKGSPGAVLDLQRRVDQAVSADHAELMTIAKDANTFFGAESVQDPYPLYERMRAAG
SVHRIANSDFYAVCGWDAVNEAIGRPEDFSSNLTATMTYTAEGTAKPFEMDPLGGPTHVL
ATADDPAHAVHRKLVLRHLAAKRIRVMEQFTVQAADRLWVDGMQDGCIEWMGAMANRLPM
MVVAELIGLPDPDIAQLVKWGYAATQLLEGLVENDQLVAAGVALMELSGYIFEQFDRAAA
DPRDNLLGELATACASGELDTLTAQVMMVTLFAAGGESTAALLGSAVWILATRPDIQQQV
RANPELLGAFIEETLRYEPPFRGHYRHVRNATTLDGTELPADSHLLLLWGAANRDPAQFE
APGEFRLDRAGGKGHISFGKGAHFCVGAALARLEARIVLRLLLDRTSVIEAADVGGWLPS
ILVRRIERLELAVQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31774
n/a
NameBDBM31774
Synonyms:CHEMBL104 | Canesten | Clotrimazole | Lotrimin | Mycelex | US9138393, Clotrimazole | cid_2812
TypeSmall organic molecule
Emp. Form.C22H17ClN2
Mol. Mass.344.837
SMILESClc1ccccc1C(c1ccccc1)(c1ccccc1)n1ccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: