Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 125 (CYP125)
LigandBDBM24656
Substrate/Competitorn/a
Meas. Tech.Binding Assay
Kd 2.16e+5± 5e+3 nM
Citation Driscoll MDMcLean KJLevy CMast NPikuleva IALafite PRigby SELeys DMunro AW Structural and biochemical characterization of Mycobacterium tuberculosis CYP142: evidence for multiple cholesterol 27-hydroxylase activities in a human pathogen. J Biol Chem 285:38270-82 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 125 (CYP125)
Name:Cytochrome P450 125 (CYP125)
Synonyms:Cholest-4-en-3-one 26-monooxygenase | Steroid C26-monooxygenase
Type:Enzyme
Mol. Mass.:48425.01
Organism:Mycobacterium tuberculosis
Description:P9WPP0
Residue:433
Sequence:
MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPG
KGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMD
APHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIA
GLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIV
TQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPE
TAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNIL
RNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKH
WQVDYTGRCPVAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM24656
n/a
NameBDBM24656
Synonyms:4-PIM | 4-Phenylimidazole | 4-phenyl-1H-imidazole | 4-phenylimidazole, 4-PI | CHEMBL14145 | US9138393, 4-Phenyl- imidazole | US9144538, 4-Phenylimidazole
TypeSmall organic molecule
Emp. Form.C9H8N2
Mol. Mass.144.1732
SMILESc1nc(c[nH]1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: