| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Macrophage migration inhibitory factor |
|---|
| Ligand | BDBM63895 |
|---|
| Substrate/Competitor | BDBM92519 |
|---|
| Meas. Tech. | Tautomerase Enzyme Assay |
|---|
| pH | 6.5±0 |
|---|
| Ki | 1.9e+2±n/a nM |
|---|
| IC50 | 1.41e+3±n/a nM |
|---|
| Citation |  Ouertatani-Sakouhi, H; El-Turk, F; Fauvet, B; Cho, MK; Pinar Karpinar, D; Le Roy, D; Dewor, M; Roger, T; Bernhagen, J; Calandra, T; Zweckstetter, M; Lashuel, HA Identification and characterization of novel classes of macrophage migration inhibitory factor (MIF) inhibitors with distinct mechanisms of action. J Biol Chem285:26581-98 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Macrophage migration inhibitory factor |
|---|
| Name: | Macrophage migration inhibitory factor |
|---|
| Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 12478.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14174 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
|---|
| BDBM63895 |
|---|
| BDBM92519 |
|---|
| Name | BDBM63895 |
|---|
| Synonyms: | 7,10-dioxo-4,5-dihydro-7H,10H-pyrano[3,2-c]pyrrolo[3,2,1-ij]quinolin-8-yl 4-fluorobenzoate | MLS000858958 | SMR000459037 | cid_2816532 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H12FNO5 |
|---|
| Mol. Mass. | 377.3221 |
|---|
| SMILES | Fc1ccc(cc1)C(=O)Oc1cc(=O)oc2c3cccc4CCn(c34)c(=O)c12 |
|---|
| Structure | 
|
|---|
Search and Browse
