Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-dependent protein kinase (PKA)
LigandBDBM92607
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
Temperature303.15±0 K
Ki 3.6e+2± 8e+1 nM
Citation Chijiwa TMishima AHagiwara MSano MHayashi KInoue TNaito KToshioka THidaka H Inhibition of forskolin-induced neurite outgrowth and protein phosphorylation by a newly synthesized selective inhibitor of cyclic AMP-dependent protein kinase, N-[2-(p-bromocinnamylamino)ethyl]-5-isoquinolinesulfonamide (H-89), of PC12D pheochromocytoma cells. J Biol Chem 265:5267-72 (1990) [PubMed]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
cAMP-dependent protein kinase (PKA)
Name:cAMP-dependent protein kinase (PKA)
Synonyms:PKA C-alpha | cAMP-dependent protein kinase catalytic (PKA) | cAMP-dependent protein kinase catalytic subunit alpha | cAMP-dependent protein kinase catalytic subunit alpha (PKA) | cAMP-dependent protein kinase catalytic subunit alpha (PKACA) | cAMP-dependent protein kinase catalytic subunit alpha (PKAc) | cAMP-dependent protein kinase catalytic subunit alpha isoform 1 | cAMP-dependent protein kinase, alpha-catalytic subunit
Type:Enzyme Catalytic Subunit
Mol. Mass.:40598.73
Organism:Homo sapiens (Human)
Description:n/a
Residue:351
Sequence:
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM92607
n/a
NameBDBM92607
Synonyms:H-88
TypeSmall Molecule
Emp. Form.C20H21N3O2S
Mol. Mass.367.465
SMILESO=S(=O)(NCCNC\C=C\c1ccccc1)c1cccc2cnccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: