Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcium/calmodulin-dependent protein kinase II
LigandBDBM50011236
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
pH7.4±0
Temperature303.15±0 K
IC50 5.8e+4± 0 nM
Citation Chijiwa THagiwara MHidaka H A newly synthesized selective casein kinase I inhibitor, N-(2-aminoethyl)-5-chloroisoquinoline-8-sulfonamide, and affinity purification of casein kinase I from bovine testis. J Biol Chem 264:4924-7 (1989) [PubMed]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Calcium/calmodulin-dependent protein kinase II
Name:Calcium/calmodulin-dependent protein kinase II
Synonyms:CaM-KII
Type:Protein
Mol. Mass.:8656.67
Organism:Bos taurus (Bovine)
Description:A5D7T0
Residue:79
Sequence:
MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIE
DDRIDDVLKGMGEKPPSGV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011236
n/a
NameBDBM50011236
Synonyms:CHEMBL344314 | Isoquinoline-5-sulfonic acid (2-amino-ethyl)-amide | Isoquinolinesulfonamide, H-9 | N-(2-aminoethyl)isoquinoline-5-sulfonamide
TypeSmall organic molecule
Emp. Form.C11H13N3O2S
Mol. Mass.251.305
SMILESNCCNS(=O)(=O)c1cccc2cnccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: