Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinesterase
LigandBDBM50100134
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Ki 3.62e+3± 1.8e+2 nM
Citation Macdonald IRMartin ERosenberry TLDarvesh S Probing the peripheral site of human butyrylcholinesterase. Biochemistry 51:7046-53 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cholinesterase
Name:Cholinesterases; ACHE & BCHE
Synonyms:Acylcholine acylhydrolase | BCHE | Butyrylcholine esterase (BChE) | Butyrylcholinesterase (BChE) | Butyrylcholinesterase (BuChE) | CHE1 | Choline esterase II | Pseudocholinesterase
Type:Homotetramer
Mol. Mass.:68422.27
Organism:Homo sapiens (Human)
Description:n/a
Residue:602
Sequence:
MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIP
YAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDC
LYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALG
FLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPG
SHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEI
LLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVNKDEGTAFLVY
GAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDV
VGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLER
RDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMT
KLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCV
GL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50100134
n/a
NameBDBM50100134
Synonyms:2-(4-Dimethylamino-phenyl)-3,6-dimethyl-benzothiazol-3-ium | 2-(4-Dimethylamino-phenyl)-3,6-dimethyl-benzothiazol-3-ium(thioflavin T) | 2-[4-(dimethylamino)phenyl]-3,6-dimethyl-1,3-benzothiazol-3-ium | CHEMBL224392 | CHEMBL57267 | Thioflavin T | Thioflavin T, 1 | [4-(3,6-dimethyl-benzothiazol-2-yl)-phenyl]-dimethyl-amine | cid_16954
TypeSmall organic molecule
Emp. Form.C17H19N2S
Mol. Mass.283.411
SMILESCN(C)c1ccc(cc1)-c1sc2cc(C)ccc2[n+]1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: