| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ribosyldihydronicotinamide dehydrogenase [quinone] |
|---|
| Ligand | BDBM92774 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Cell Assay |
|---|
| IC50 | >1.0e+4±n/a nM |
|---|
| Citation |  Yan, C; Dufour, M; Siegel, D; Reigan, P; Gomez, J; Shieh, B; Moody, CJ; Ross, D Indolequinone inhibitors of NRH:quinone oxidoreductase 2. Characterization of the mechanism of inhibition in both cell-free and cellular systems. Biochemistry50:6678-88 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ribosyldihydronicotinamide dehydrogenase [quinone] |
|---|
| Name: | Ribosyldihydronicotinamide dehydrogenase [quinone] |
|---|
| Synonyms: | Metallothionein-3 | NMOR2 | NQO2 | NQO2_HUMAN | NRH dehydrogenase [quinone] 2 | NRH:quinone oxidoreductase 2 | QR2 | Quinone reductase 2 | Quinone reductase 2 (NQO2) | Ribosyldihydronicotinamide dehydrogenase [quinone] |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25917.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P16083 |
|---|
| Residue: | 231 |
|---|
| Sequence: | MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
|
|
|
|---|
| BDBM92774 |
|---|
| n/a |
|---|
| Name | BDBM92774 |
|---|
| Synonyms: | Indolequinone, compd 8 |
|---|
| Type | Small molecule |
|---|
| Emp. Form. | C22H27N3O3 |
|---|
| Mol. Mass. | 381.4681 |
|---|
| SMILES | CN(C)CCC=Nc1cc(O)c2n(C)c(C)c(COc3ccccc3)c2c1O |w:6.6| |
|---|
| Structure | 
|
|---|
Search and Browse
