Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNicotinamidase (Pnc1)
LigandBDBM92853
Substrate/Competitorn/a
Meas. Tech.GDH-Coupled Nicotinamidase Assay
Ki 500000±0 nM
Citation French JBCen YVrablik TLXu PAllen EHanna-Rose WSauve AA Characterization of nicotinamidases: steady state kinetic parameters, classwide inhibition by nicotinaldehydes, and catalytic mechanism. Biochemistry 49:10421-39 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nicotinamidase (Pnc1)
Name:Nicotinamidase (Pnc1)
Synonyms:Nicotine deamidase
Type:Enzyme
Mol. Mass.:24990.99
Organism:Saccharomyces cerevisiae
Description:P53184
Residue:216
Sequence:
MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISF
AKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIV
DKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGY
KTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM92853
n/a
NameBDBM92853
Synonyms:Nicotinamidase Inhibitor, 20
TypeSmall molecule
Emp. Form.C6H4ClNO
Mol. Mass.141.555
SMILESClc1ncccc1C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: