Reaction Details |
| Report a problem with these data |
Target | Nicotinamidase |
---|
Ligand | BDBM92856 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | GDH-Coupled Nicotinamidase Assay |
---|
Ki | 85000±0 nM |
---|
Citation | French, JB; Cen, Y; Vrablik, TL; Xu, P; Allen, E; Hanna-Rose, W; Sauve, AA Characterization of nicotinamidases: steady state kinetic parameters, classwide inhibition by nicotinaldehydes, and catalytic mechanism. Biochemistry49:10421-39 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Nicotinamidase |
---|
Name: | Nicotinamidase |
Synonyms: | Nicotinamidase (Pnc1) | Nicotine deamidase | PNC1 | PNC1_YEAST |
Type: | Enzyme |
Mol. Mass.: | 24990.99 |
Organism: | Saccharomyces cerevisiae |
Description: | P53184 |
Residue: | 216 |
Sequence: | MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISF
AKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIV
DKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGY
KTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK
|
|
|
BDBM92856 |
---|
n/a |
---|
Name | BDBM92856 |
Synonyms: | Nicotinamidase Inhibitor, 23 | PncA Inhibitor, 5 |
Type | Smalll molecule |
Emp. Form. | C6H4N2 |
Mol. Mass. | 104.1094 |
SMILES | N#Cc1cccnc1 |
Structure |
|