| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Isochorismatase family protein |
|---|
| Ligand | BDBM92854 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | GDH-Coupled Nicotinamidase Assay |
|---|
| Ki | 730±290 nM |
|---|
| Citation |  French, JB; Cen, Y; Vrablik, TL; Xu, P; Allen, E; Hanna-Rose, W; Sauve, AA Characterization of nicotinamidases: steady state kinetic parameters, classwide inhibition by nicotinaldehydes, and catalytic mechanism. Biochemistry49:10421-39 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Isochorismatase family protein |
|---|
| Name: | Isochorismatase family protein |
|---|
| Synonyms: | Nicotinamidase (SpNic) | Pyrazinamidase/nicotinamidase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21361.69 |
|---|
| Organism: | Streptococcus pneumoniae |
|---|
| Description: | A0A098ZGI7 |
|---|
| Residue: | 191 |
|---|
| Sequence: | MTKALISIDYTEDFVADSGKLTAGAPAQAISDAISKVTRLAFERGDYIFFTIDAHEENDC
FHPESKLFPPHNLIGTSGRNLYGDLGIFYQEHGSDSRVFWMDKRHYSAFSGTDLDIRLRE
RRVSTVILTGVLTDICVLHTAIDAYNLGYDIEIVKPAVASIWPENHQFALGHFKNTLGAK
LVDENLNELSE
|
|
|
|---|
| BDBM92854 |
|---|
| n/a |
|---|
| Name | BDBM92854 |
|---|
| Synonyms: | Nicotinamidase Inhibitor, 21 |
|---|
| Type | Small molecule |
|---|
| Emp. Form. | C6H4FNO |
|---|
| Mol. Mass. | 125.1005 |
|---|
| SMILES | Fc1ccc(C=O)cn1 |
|---|
| Structure | 
|
|---|
Search and Browse
