Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNicotinamidase (CePNC1)
LigandBDBM92851
Substrate/Competitorn/a
Meas. Tech.GDH-Coupled Nicotinamidase Assay
Ki 310±50 nM
Citation French JBCen YVrablik TLXu PAllen EHanna-Rose WSauve AA Characterization of nicotinamidases: steady state kinetic parameters, classwide inhibition by nicotinaldehydes, and catalytic mechanism. Biochemistry 49:10421-39 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nicotinamidase (CePNC1)
Name:Nicotinamidase (CePNC1)
Synonyms:Nicotine deamidase
Type:Enzyme
Mol. Mass.:37789.90
Organism:Caenorhabditis elegans
Description:Q9N426
Residue:335
Sequence:
MFPCPKLIFPRLMAFIGLIWMVHSDNSATTNNNTILGNQSLEAIPEQLSELTGITVEESE
RIMESWLGNRQLDLRTSVLFDQEVLSRLRSLRVALLVVDFQNDFVDGSLKIGDGDAGQEP
SSAITPLNELLQLSSWDLVVYTKDWHPHNHISFLSQAHNSDRVMDEKDENKTLGFFDSVQ
FLKPIKTEQVLYPDHCIQKSWGSDIHPEIYIADNAEYIMKGVDPYLDSYSAFNDNNGRSK
TELEDLLRRENIDAVVIAGLAYDICVRFTCLDAVKQNFLAAVIPECSAGLTKKGIEESEM
AFKKQGVAMISKDEARGITEGGFLPREWVQRIVKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM92851
n/a
NameBDBM92851
Synonyms:Nicotinamidase Inhibitor, 18
TypeSmall molecule
Emp. Form.C7H7NO2
Mol. Mass.137.136
SMILESCOc1cncc(C=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: