Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNS3 protein
LigandBDBM92897
Substrate/Competitorn/a
Meas. Tech.Competitive Inhibition Assay
Ki 170±33 nM
Citation Dahl GArenas OGDanielson UH Hepatitis C virus NS3 protease is activated by low concentrations of protease inhibitors. Biochemistry 48:11592-602 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
NS3 protein
Name:NS3 protein
Synonyms:n/a
Type:Protein
Mol. Mass.:45665.89
Organism:Hepatitis C virus
Description:Q04045
Residue:428
Sequence:
VFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYM
SKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILG
IGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGG
RHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVSTDALMTGFTGDF
DSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERP
SGMFDSSVLCECYDAGCAWYELTPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHI
DAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRL
GAVQNEVT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM92897
n/a
NameBDBM92897
Synonyms:NS3 Protease Inhibitor, 8
TypeSmall molecule
Emp. Form.C42H51N5O9S
Mol. Mass.801.947
SMILESCCC[C@H](NC(=O)[C@@H]1C[C@H](CN1C(=O)[C@@H](NC(=O)OC(C)(C)C)C(C)C)Oc1cc(nc2cc(OC)ccc12)-c1ccccc1)C(=O)NS(=O)(=O)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: