Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Chk1
LigandBDBM92908
Substrate/Competitorn/a
Meas. Tech.Surface Plasmon Resonance BindingAssay
pH8±0
Temperature293.15±0 K
Ki 2.9e+2± 7e+1 nM
Citation Vanderpool DJohnson TOPing CBergqvist SAlton GPhonephaly SRui ELuo CDeng YLGrant SQuenzer TMargosiak SRegister JBrown EErmolieff J Characterization of the CHK1 allosteric inhibitor binding site. Biochemistry 48:9823-30 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Serine/threonine-protein kinase Chk1
Name:Serine/threonine-protein kinase Chk1/2
Synonyms:CHK1 checkpoint homolog | Checkpoint kinase-1 (CHK1) | Serine/threonine-protein kinase Chk1
Type:Enzyme Catalytic Domain
Mol. Mass.:54443.02
Organism:Homo sapiens (Human)
Description:gi_166295192
Residue:476
Sequence:
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLK
RREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM92908
n/a
NameBDBM92908
Synonyms:CHK1 compound 3
TypeSmall molecule
Emp. Form.C22H22N3O4
Mol. Mass.392.4272
SMILESCC(C)(C)c1ccc(cc1[N+](O)=O)C(=O)NC(=O)Nc1cccc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: