| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase A |
|---|
| Ligand | BDBM92914 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | PPIase Assay |
|---|
| pH | 7.8±n/a |
|---|
| Temperature | 278.15±n/a K |
|---|
| Ki | 1.7e+3± 5e+2 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Daum, S; Schumann, M; Mathea, S; Aumüller, T; Balsley, MA; Constant, SL; de Lacroix, BF; Kruska, F; Braun, M; Schiene-Fischer, C Isoform-specific inhibition of cyclophilins. Biochemistry48:6268-77 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase A |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase A |
|---|
| Synonyms: | CYPA | CYPA PPIase | Cyclophilin A | Cyclosporin A-binding protein | PPIA | PPIA_HUMAN | PPIase A | Peptidyl-prolyl cis-trans isomerase A | Rotamase A |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 18015.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P62937 |
|---|
| Residue: | 165 |
|---|
| Sequence: | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
|
|
|
|---|
| BDBM92914 |
|---|
| n/a |
|---|
| Name | BDBM92914 |
|---|
| Synonyms: | Aryl 1-indanylketone, 3 |
|---|
| Type | Small molecule |
|---|
| Emp. Form. | C23H20FNO3 |
|---|
| Mol. Mass. | 377.4082 |
|---|
| SMILES | COc1ccc(F)cc1-c1cc(N)c(O)c(c1)C(=O)C1CCc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
