| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase B |
|---|
| Ligand | BDBM92915 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | PPIase Assay |
|---|
| pH | 7.8±n/a |
|---|
| Temperature | 278.15±n/a K |
|---|
| Ki | 2.1e+3± 3e+2 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Daum, S; Schumann, M; Mathea, S; Aumüller, T; Balsley, MA; Constant, SL; de Lacroix, BF; Kruska, F; Braun, M; Schiene-Fischer, C Isoform-specific inhibition of cyclophilins. Biochemistry48:6268-77 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase B |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase B |
|---|
| Synonyms: | CYP-S1 | CYPB | Cyclophilin B | Cyclophilin B (CypB) | PPIB | PPIB_HUMAN | PPIase | Peptidyl-prolyl cis-trans isomerase B | Rotamase | S-cyclophilin | SCYLP |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23751.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P23284 |
|---|
| Residue: | 216 |
|---|
| Sequence: | MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRV
IFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG
ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVR
KVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE
|
|
|
|---|
| BDBM92915 |
|---|
| n/a |
|---|
| Name | BDBM92915 |
|---|
| Synonyms: | Aryl 1-indanylketone, 4 |
|---|
| Type | Small molecule |
|---|
| Emp. Form. | C24H19F3O3 |
|---|
| Mol. Mass. | 412.4011 |
|---|
| SMILES | COc1ccc(cc1C(=O)C1CCc2ccccc12)-c1ccc(OC(F)(F)F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
