Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOxaloacetate decarboxylase (PA4872)
LigandBDBM92967
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Ki 3000000±2000000 nM
Citation Narayanan BCNiu WHan YZou JMariano PSDunaway-Mariano DHerzberg O Structure and function of PA4872 from Pseudomonas aeruginosa, a novel class of oxaloacetate decarboxylase from the PEP mutase/isocitrate lyase superfamily. Biochemistry 47:167-82 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oxaloacetate decarboxylase (PA4872)
Name:Oxaloacetate decarboxylase (PA4872)
Synonyms:Oxaloacetate decarboxylase (PA4872) Y212F
Type:Protein
Mol. Mass.:31314.95
Organism:Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
Description:Q9HUU1
Residue:287
Sequence:
MHRASHHELRAMFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLQVLAAP
DFALITLSEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTL
LPAQFGRKSTDLICVEEGVGKIRAALEARVDPALTIIARTNAELIDVDAVIQRTLAYQEA
GADGICLVGVRDFAHLEAIAEHLHIPLMLVTYGNPQLRDDARLARLGVRVVVNGHAAYFA
AIKATYDCLREERGAVASDLTASELSKKYTFPEEYQAWARDYMEVKE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM92967
n/a
NameBDBM92967
Synonyms:Phosphonopyruvate
TypeSmall molecule
Emp. Form.C3H2O6P
Mol. Mass.165.0198
SMILES[O-]C(=O)C(=O)CP([O-])([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: