Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM279581 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | [3H]PK 11195 radio-assay |
---|
Ki | 600±n/a nM |
---|
Citation | Gavish, M; Veenman, JA; Shterenberg, A; Marek, I; Vainshtein, A; Avital, A Quinazoline scaffold based compounds, pharmaceutical compositions and methods of use thereof US Patent US10035780 Publication Date 7/31/2018 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
Type: | Enzyme |
Mol. Mass.: | 18834.74 |
Organism: | Homo sapiens (Human) |
Description: | P30536 |
Residue: | 169 |
Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
BDBM279581 |
---|
n/a |
---|
Name | BDBM279581 |
Synonyms: | US10035780, Compound 5 |
Type | Small organic molecule |
Emp. Form. | C17H14ClN3O2 |
Mol. Mass. | 327.765 |
SMILES | CN(C)C(=O)Oc1nc(nc2ccccc12)-c1ccccc1Cl |
Structure |
|