| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM93035 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Competition Binding Assay |
|---|
| Ki | 36860±8300 nM |
|---|
| Citation |  Renault, N; Laurent, X; Farce, A; El Bakali, J; Mansouri, R; Gervois, P; Millet, R; Desreumaux, P; Furman, C; Chavatte, P Virtual Screening of CB2 Receptor Agonists from Bayesian Network and High-Throughput Docking: Structural Insights into Agonist-Modulated GPCR Features. Chem Biol Drug Des81:442-454 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM93035 |
|---|
| n/a |
|---|
| Name | BDBM93035 |
|---|
| Synonyms: | CB2 Inhibitor, 11 |
|---|
| Type | Small molecule |
|---|
| Emp. Form. | C25H25FN2O3S |
|---|
| Mol. Mass. | 452.541 |
|---|
| SMILES | CC1=CC(C(=O)CN2C(=O)NC(C)(C2=O)c2ccc(F)cc2)=C(C)C1CCc1cccs1 |t:1,23| |
|---|
| Structure | 
|
|---|
Search and Browse
