Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-ketoacyl-ACP synthase (KasA)
LigandBDBM93051
Substrate/Competitorn/a
Meas. Tech.Binding Fluorescence Titrations
pH8.5±0
Kd 3.14e+4± 2.0e+3 nM
Citation Kapilashrami KBommineni GRMachutta CAKim PLai CTSimmerling CPicart FTonge PJ Thiolactomycin-based -Ketoacyl-AcpM Synthase A (KasA) Inhibitors: FRAGMENT-BASED INHIBITOR DISCOVERY USING TRANSIENT ONE-DIMENSIONAL NUCLEAR OVERHAUSER EFFECT NMR SPECTROSCOPY. J Biol Chem 288:6045-52 (2013) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Beta-ketoacyl-ACP synthase (KasA)
Name:Beta-ketoacyl-ACP synthase (KasA)
Synonyms:β-ketoacyl-ACP synthase I (KasA) | 3-oxoacyl-[acyl-carrier-protein] synthase 1
Type:Protein
Mol. Mass.:43305.57
Organism:Mycobacterium tuberculosis
Description:P9WQD9
Residue:416
Sequence:
MSQPSTANGGFPSVVVTAVTATTSISPDIESTWKGLLAGESGIHALEDEFVTKWDLAVKI
GGHLKDPVDSHMGRLDMRRMSYVQRMGKLLGGQLWESAGSPEVDPDRFAVVVGTGLGGAE
RIVESYDLMNAGGPRKVSPLAVQMIMPNGAAAVIGLQLGARAGVMTPVSACSSGSEAIAH
AWRQIVMGDADVAVCGGVEGPIEALPIAAFSMMRAMSTRNDEPERASRPFDKDRDGFVFG
EAGALMLIETEEHAKARGAKPLARLLGAGITSDAFHMVAPAADGVRAGRAMTRSLELAGL
SPADIDHVNAHGTATPIGDAAEANAIRVAGCDQAAVYAPKSALGHSIGAVGALESVLTVL
TLRDGVIPPTLNYETPDPEIDLDVVAGEPRYGDYRYAVNNSFGFGGHNVALAFGRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM93051
n/a
NameBDBM93051
Synonyms:TLM analog, 8
TypeSmall molecule
Emp. Form.C12H14O4S
Mol. Mass.254.302
SMILESCOC(=O)C1C(=O)S[C@](C)(\C=C(/C)C=C)C1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: