Reaction Details |
| Report a problem with these data |
Target | Cathepsin L |
---|
Ligand | BDBM93184 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Assay |
---|
pH | 5.5±0 |
---|
Ki | 18±0.0 nM |
---|
Citation | Yamashita, DS; Dong, X; Oh, HJ; Brook, CS; Tomaszek, TA; Szewczuk, L; Tew, DG; Veber, DF Solid-phase synthesis of a combinatorial array of 1,3-bis(acylamino)-2-butanones, inhibitors of the cysteine proteases cathepsins K and L. J Comb Chem1:207-15 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Cathepsin L |
---|
Name: | Cathepsin L |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 19098.77 |
Organism: | Homo sapiens (Human) |
Description: | Q6LAF7 |
Residue: | 175 |
Sequence: | VTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDY
AFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPI
SVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESSESDNNKYWLVKN
|
|
|
BDBM93184 |
---|
n/a |
---|
Name | BDBM93184 |
Synonyms: | Cathepsin Inhibitor, Column 6 Row 2 |
Type | Small molecule |
Emp. Form. | C35H32N4O4S |
Mol. Mass. | 604.718 |
SMILES | CC(NC(=O)[C@H](Cc1ccccc1)NC(=O)c1cc2ccccc2s1)C(=O)CNC(=O)Cc1cccc(c1)-c1ccccn1 |r| |
Structure |
|