Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSRC
LigandBDBM93207
Substrate/Competitorn/a
Meas. Tech.Fluorescence Assay
pH7.5±0
Temperature298.15±0 K
IC50<0.5±0.0 nM
Citation Brigham JLPerera BGMaly DJ A Hexylchloride-Based Catch-and-Release System for Chemical Proteomic Applications. ACS Chem Biol 8:691-9 (2013) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
SRC
Name:SRC
Synonyms:HCK | Tyrosine-protein kinase Blk | Tyrosine-protein kinase HCK | Tyrosine-protein kinase HCK
Type:Enzyme Catalytic Domain
Mol. Mass.:59600.18
Organism:Homo sapiens (Human)
Description:gi_30795229
Residue:526
Sequence:
MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIK
PGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSL
ATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSY
SLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVP
CMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
AFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLID
FSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE
NCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM93207
n/a
NameBDBM93207
Synonyms:Kinase inhibitor, 5
TypeSmall molecule
Emp. Form.C31H26F3N5O2
Mol. Mass.557.5656
SMILESCc1ccc(NC(=O)c2cccc(c2)C(F)(F)F)cc1-c1ccc2nc(Nc3ccc(OCCN)cc3)ncc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: