| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
|---|
| Ligand | BDBM116257 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition of Cellular Release of Amyloid Peptide 1-40 |
|---|
| IC50 | 3.00±n/a nM |
|---|
| Citation |  Badiger, S; Chebrolu, M; Hurth, K; Jacquier, S; Lueoend, RM; Machauer, R; Rueeger, H; Tintelnot-Blomley, M; Veenstra, SJ; Voegtle, M Heterocyclic derivatives and their use in the treatment of neurological disorders US Patent US10035794 Publication Date 7/31/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
|---|
| Name: | Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
|---|
| Synonyms: | Cytosolic NADP-isocitrate dehydrogenase (IDH1)(R132H) | IDH1 | IDH1 R132H | IDH1(R132H) | IDHC_HUMAN | Isocitrate dehydrogenase (IDH1)(R132H) | Isocitrate dehydrogenase 1 mutant (R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (IDH)(R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (IDH1)(R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (R132H) | PICD |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 46641.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human IDH1 R132H (SEQ ID No. 2 in patent). First three are removed. Google patent parsed wrong. |
|---|
| Residue: | 414 |
|---|
| Sequence: | MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
|
|
|
|---|
| BDBM116257 |
|---|
| n/a |
|---|
| Name | BDBM116257 |
|---|
| Synonyms: | US10035794, Example 34 | US10683287, Example 34 | US8637508, 34 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H15ClF7N5O2 |
|---|
| Mol. Mass. | 513.797 |
|---|
| SMILES | C[C@]1(CO[C@](C)(C(N)=N1)C(F)(F)F)c1nc(NC(=O)c2ncc(cc2Cl)C(F)(F)F)ccc1F |r,c:7| |
|---|
| Structure | 
|
|---|
Search and Browse
