new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSUMO/sentrin specific peptidase family member 8
LigandBDBM93697
Substrate/Competitorn/a
IC50 445±110 nM
Citation PubChem PC Dose-response confirmation of uHTS inhibitor hits of Sentrin-Specific Protease 8 using a kinetic assay with Nedd8 Protein Substrate PubChem Bioassay (2012)[AID]
More Info.:Get all data from this article
 
SUMO/sentrin specific peptidase family member 8
Name:SUMO/sentrin specific peptidase family member 8
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:24104.52
Organism:Homo sapiens (Human)
Description:gi_262118306
Residue:212
Sequence:
MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQ
FIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDS
HSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFR
QQTESLLQLLTPAYITKKRGEWKDLITTLAKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM93697
n/a
NameBDBM93697
Synonyms:MLS001181286 | SMR000502433 | cid_3897207
TypeSmall organic molecule
Emp. Form.C18H12N4O6
Mol. Mass.380.3111
SMILESCC(=O)Nn1c(=O)c2ccc3c4c(ccc(c24)c1=O)c(=O)n(NC(C)=O)c3=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: