new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMSRA protein
LigandBDBM95358
Substrate/Competitorn/a
IC50 102427±n/a nM
Citation PubChem PC Absorbance-based biochemical high throughput dose response assay to identify inhibitors of Methionine sulfoxide reductase A (MsrA) PubChem Bioassay (2013)[AID]
More Info.:Get all data from this article
 
MSRA protein
Name:MSRA protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:25822.90
Organism:Bos taurus
Description:gi_73586699
Residue:233
Sequence:
MLSATRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM95358
n/a
NameBDBM95358
Synonyms:1-Methyl-6-oxo-1,6-dihydro-pyridine-3-carboxylic acid (2,4,5-trimethoxy-benzylidene)-hydrazide | 1-methyl-6-oxidanylidene-N-[(E)-(2,4,5-trimethoxyphenyl)methylideneamino]pyridine-3-carboxamide | 1-methyl-6-oxo-N-[(E)-(2,4,5-trimethoxyphenyl)methylideneamino]-3-pyridinecarboxamide | 1-methyl-6-oxo-N-[(E)-(2,4,5-trimethoxyphenyl)methylideneamino]pyridine-3-carboxamide | 6-keto-1-methyl-N-[(E)-(2,4,5-trimethoxybenzylidene)amino]nicotinamide | MLS000566877 | SMR000175526 | cid_6868941
TypeSmall organic molecule
Emp. Form.C17H19N3O5
Mol. Mass.345.3499
SMILESCOc1cc(OC)c(\C=N\NC(=O)c2ccc(=O)n(C)c2)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: