new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMSRA protein
LigandBDBM95389
Substrate/Competitorn/a
IC50 67697±n/a nM
Citation PubChem PC Absorbance-based biochemical high throughput dose response assay to identify inhibitors of Methionine sulfoxide reductase A (MsrA) PubChem Bioassay (2013)[AID]
More Info.:Get all data from this article
 
MSRA protein
Name:MSRA protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:25822.90
Organism:Bos taurus
Description:gi_73586699
Residue:233
Sequence:
MLSATRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM95389
n/a
NameBDBM95389
Synonyms:2-(7-Morpholin-4-yl-4-nitro-benzo[1,2,5]oxadiazol-5-ylamino)-phenol | 6-[(7-morpholin-4-yl-4-nitro-1,3-dihydro-2,1,3-benzoxadiazol-5-yl)imino]cyclohexa-2,4-dien-1-one | 6-[(7-morpholino-4-nitro-1,3-dihydrobenzofurazan-5-yl)imino]cyclohexa-2,4-dien-1-one | 6-[[7-(4-morpholinyl)-4-nitro-1,3-dihydro-2,1,3-benzoxadiazol-5-yl]imino]-1-cyclohexa-2,4-dienone | MLS000332132 | SMR000221550 | cid_6054788
TypeSmall organic molecule
Emp. Form.C16H15N5O5
Mol. Mass.357.3208
SMILES[O-]c1ccccc1Nc1cc(N2CCOCC2)c2[nH+]onc2c1[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: