new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMSRA protein
LigandBDBM71076
Substrate/Competitorn/a
IC50 44774±n/a nM
Citation PubChem PC Absorbance-based biochemical high throughput dose response assay to identify inhibitors of Methionine sulfoxide reductase A (MsrA) PubChem Bioassay (2013)[AID]
More Info.:Get all data from this article
 
MSRA protein
Name:MSRA protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:25822.90
Organism:Bos taurus
Description:gi_73586699
Residue:233
Sequence:
MLSATRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM71076
n/a
NameBDBM71076
Synonyms:1,1,3-trimethyl-N-[(E)-1-(methylthio)-2-nitroethenyl]-2,3-dihydroinden-4-amine | 1,1,3-trimethyl-N-[(E)-1-methylsulfanyl-2-nitro-ethenyl]-2,3-dihydroinden-4-amine | 1,1,3-trimethyl-N-[(E)-1-methylsulfanyl-2-nitroethenyl]-2,3-dihydroinden-4-amine | MLS000755780 | N-[(E)-1-(methylsulfanyl)-2-nitroethenyl]-N-(1,1,3-trimethyl-2,3-dihydro-1H-inden-4-yl)amine | SMR000337443 | [(E)-1-(methylthio)-2-nitro-vinyl]-(1,1,3-trimethylindan-4-yl)amine | cid_16195208
TypeSmall organic molecule
Emp. Form.C15H20N2O2S
Mol. Mass.292.397
SMILESCS\C([CH-][N+]([O-])=O)=[NH+]/c1cccc2c1C(C)CC2(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: