Reaction Details |
| Report a problem with these data |
Target | Mitochondrial peptide methionine sulfoxide reductase |
---|
Ligand | BDBM71076 |
---|
Substrate/Competitor | n/a |
---|
IC50 | 44774±n/a nM |
---|
Citation | PubChem, PC Absorbance-based biochemical high throughput dose response assay to identify inhibitors of Methionine sulfoxide reductase A (MsrA) PubChem Bioassay(2013)[AID] |
---|
More Info.: | Get all data from this article |
---|
|
Mitochondrial peptide methionine sulfoxide reductase |
---|
Name: | Mitochondrial peptide methionine sulfoxide reductase |
Synonyms: | MSRA | MSRA protein | MSRA_BOVIN |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25822.90 |
Organism: | Bos taurus |
Description: | gi_73586699 |
Residue: | 233 |
Sequence: | MLSATRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
|
|
|
BDBM71076 |
---|
n/a |
---|
Name | BDBM71076 |
Synonyms: | 1,1,3-trimethyl-N-[(E)-1-(methylthio)-2-nitroethenyl]-2,3-dihydroinden-4-amine | 1,1,3-trimethyl-N-[(E)-1-methylsulfanyl-2-nitro-ethenyl]-2,3-dihydroinden-4-amine | 1,1,3-trimethyl-N-[(E)-1-methylsulfanyl-2-nitroethenyl]-2,3-dihydroinden-4-amine | MLS000755780 | N-[(E)-1-(methylsulfanyl)-2-nitroethenyl]-N-(1,1,3-trimethyl-2,3-dihydro-1H-inden-4-yl)amine | SMR000337443 | [(E)-1-(methylthio)-2-nitro-vinyl]-(1,1,3-trimethylindan-4-yl)amine | cid_16195208 |
Type | Small organic molecule |
Emp. Form. | C15H20N2O2S |
Mol. Mass. | 292.397 |
SMILES | CS\C([CH-][N+]([O-])=O)=[NH+]/c1cccc2c1C(C)CC2(C)C |
Structure |
|