new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMSRA protein
LigandBDBM58032
Substrate/Competitorn/a
IC50 12118±n/a nM
Citation PubChem PC Absorbance-based biochemical high throughput dose response assay to identify inhibitors of Methionine sulfoxide reductase A (MsrA) PubChem Bioassay (2013)[AID]
More Info.:Get all data from this article
 
MSRA protein
Name:MSRA protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:25822.90
Organism:Bos taurus
Description:gi_73586699
Residue:233
Sequence:
MLSATRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM58032
n/a
NameBDBM58032
Synonyms:2-(1,3-Dioxo-indan-2-yl)-2-(2-methyl-1H-indol-3-yl)-malononitrile | 2-(1,3-diketoindan-2-yl)-2-(2-methyl-1H-indol-3-yl)malononitrile | 2-(1,3-dioxo-2-indenyl)-2-(2-methyl-1H-indol-3-yl)propanedinitrile | 2-(1,3-dioxoinden-2-yl)-2-(2-methyl-1H-indol-3-yl)propanedinitrile | 2-[1,3-bis(oxidanylidene)inden-2-yl]-2-(2-methyl-1H-indol-3-yl)propanedinitrile | MLS000779290 | SMR000416004 | cid_582632
TypeSmall organic molecule
Emp. Form.C21H13N3O2
Mol. Mass.339.3468
SMILESCc1[nH]c2ccccc2c1C(C#N)(C#N)C1C(=O)c2ccccc2C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: