new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMSRA protein
LigandBDBM91505
Substrate/Competitorn/a
IC50 35888±n/a nM
Citation PubChem PC Absorbance-based biochemical high throughput dose response assay to identify inhibitors of Methionine sulfoxide reductase A (MsrA) PubChem Bioassay (2013)[AID]
More Info.:Get all data from this article
 
MSRA protein
Name:MSRA protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:25822.90
Organism:Bos taurus
Description:gi_73586699
Residue:233
Sequence:
MLSATRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM91505
n/a
NameBDBM91505
Synonyms:2-(4-nitrophenyl)-3,5-diphenyl-1,2,3,4-tetrazol-2-ium;bromide | 2-(4-nitrophenyl)-3,5-diphenyl-tetrazol-2-ium;bromide | 2-(4-nitrophenyl)-3,5-diphenyltetrazol-2-ium;bromide | 3-(4-nitrophenyl)-2,5-diphenyl-2H-tetrazol-3-ium bromide | MLS001163334 | SMR000497235 | cid_2915045
TypeSmall organic molecule
Emp. Form.C19H14N5O2
Mol. Mass.344.3462
SMILES[O-][N+](=O)c1ccc(cc1)-[n+]1nc(nn1-c1ccccc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: