| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proto-oncogene tyrosine-protein kinase Src |
|---|
| Ligand | BDBM4053 |
|---|
| Substrate/Competitor | Poly(E:Y) |
|---|
| Meas. Tech. | Kinase Inhibition Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 890±n/a nM |
|---|
| Citation |  Boschelli, DH; Wu, Z; Klutchko, SR; Showalter, HD; Hamby, JM; Lu, GH; Major, TC; Dahring, TK; Batley, B; Panek, RL; Keiser, J; Hartl, BG; Kraker, AJ; Klohs, WD; Roberts, BJ; Patmore, S; Elliott, WL; Steinkampf, R; Bradford, LA; Hallak, H; Doherty, AM Synthesis and tyrosine kinase inhibitory activity of a series of 2-amino-8H-pyrido[2,3-d]pyrimidines: identification of potent, selective platelet-derived growth factor receptor tyrosine kinase inhibitors. J Med Chem41:4365-77 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Proto-oncogene tyrosine-protein kinase Src |
|---|
| Name: | Proto-oncogene tyrosine-protein kinase Src |
|---|
| Synonyms: | Calmodulin/Proto-oncogene tyrosine-protein kinase Src | Protein cereblon/Tyrosine-protein kinase SRC | Proto-oncogene c-Src | Proto-oncogene tyrosine-protein kinase Src (c-Src) | SRC | SRC1 | SRC_HUMAN | Tyrosine-protein kinase Src (SRC) | V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) | c-Src | p60-Src | pp60c-src |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 59838.60 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P12931 |
|---|
| Residue: | 536 |
|---|
| Sequence: | MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
|
|
|
|---|
| BDBM4053 |
|---|
| Poly(E:Y) |
|---|
| Name: | Poly(E:Y) |
|---|
| Synonyms: | n/a |
|---|
| Type: | Random polymer |
|---|
| Mol. Mass.: | 358.43 |
|---|
| Organism: | n/a |
|---|
| Description: | Random copolymer of glutamic acid and tyrosine (4:1). 50 uM ATP containing 0.4 uCi of [gamma-32P]ATP as co-substrate |
|---|
| Residue: | 3 |
|---|
| Sequence: | |
|---|
Search and Browse
