Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTumor necrosis factor
LigandBDBM102784
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Ki 0.16±0.0 nM
IC50 229±0.0 nM
Citation Kozlowski JAYu WWong MKKim SHTong LLavey BJShankar BBYang DFeltz RKosinski AMZhou GRizvi RKDai CFire LGirijavallabhan VLi DPopovici-Muller JRichard JERosner KESiddiqui MAYang L Compounds for the treatment of inflammatory disorders US Patent  US8541572 Publication Date 9/24/2013
More Info.:Get all data from this article,  Assay Method
 
Tumor necrosis factor
Name:Tumor necrosis factor
Synonyms:Cachectin | TNF | TNF-a | TNFA | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNF╬▒) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha
Type:Enzyme
Mol. Mass.:25645.11
Organism:Homo sapiens (Human)
Description:P01375
Residue:233
Sequence:
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM102784
n/a
NameBDBM102784
Synonyms:US8541572, 2215
TypeSmall organic molecule
Emp. Form.C25H22N6O6
Mol. Mass.502.4788
SMILESCOc1ccc2CN(C[C@]3(NC(=O)NC3=O)C#Cc3ccc(cc3)C3(CN)NC(=O)NC3=O)C(=O)c2c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: