Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGuanylate cyclase soluble subunit alpha-1
LigandBDBM280823
Substrate/Competitorn/a
Meas. Tech.sGC Binding Assay
pH7.4±n/a
Ki 0.045±n/a nM
Commentsextracted
Citation Berger RChen YLi GGarfunkle JLi HMiao SRaghavan SSmith CJStelmach JWhitehead AZhang RZhang YFu JJi GJiang F Soluble guanylate cyclase stimulators US Patent  US10030027 Publication Date 7/24/2018
More Info.:Get all data from this article,  Assay Method
 
Guanylate cyclase soluble subunit alpha-1
Name:Guanylate cyclase soluble subunit alpha-1
Synonyms:GCS-alpha-1 | GCS-alpha-3 | GUC1A3 | GUCSA3 | GUCY1A1 | GUCY1A3 | Guanylate cyclase soluble (GCS-alpha-1) | Guanylate cyclase soluble subunit alpha-3 | Solube guanylate cyclase alpha-1 (sGC alpha-1) | Solube guanylate cyclase alpha-1 (sGCalpha) | soluble guanylate cyclase alpha-1 (sGC)
Type:Enzyme
Mol. Mass.:77457.21
Organism:Homo sapiens (Human)
Description:Q02108
Residue:690
Sequence:
MFCTKLKDLKITGECPFSLLAPGQVPNESSEEAAGSSESCKATVPICQDIPEKNIQESLP
QRKTSRSRVYLHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAE
QAVAAGVPVEVIKESLGEEVFKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSHCQEAG
KRGRLEDASILCLDKEDDFLHVYYFFPKRTTSLILPGIIKAAAHVLYETEVEVSLMPPCF
HNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQ
FGNGIRRLMNRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRVRRWDNSVKKS
SRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR
AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNV
TMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHK
ESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNN
VTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAY
QQGTNSKPCFQKKDVEDGNANFLGKASGID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM280823
n/a
NameBDBM280823
Synonyms:(5S)-(3-(4-{4-amino-2-[1- (2-fluorobenzyl)-1H- pyrazolo[3,4-b]pyridin-3- yl]-5-methyl-6-oxo-6,7- dihydro-5H-pyrrolo[2,3- d]pyrimidin-5- yl}phenyl)propanoyl)-L- alanine | US10030027, Example 103B
TypeSmall organic molecule
Emp. Form.C32H29FN8O4
Mol. Mass.608.6223
SMILESC[C@H](NC(=O)CCc1ccc(cc1)[C@]1(C)C(=O)Nc2nc(nc(N)c12)-c1nn(Cc2ccccc2F)c2ncccc12)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: