Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGuanylate cyclase soluble subunit alpha-1
LigandBDBM280965
Substrate/Competitorn/a
Meas. Tech.sGC Binding Assay
pH7.4±n/a
Ki 0.075±n/a nM
Commentsextracted
Citation Berger RChen YLi GGarfunkle JLi HMiao SRaghavan SSmith CJStelmach JWhitehead AZhang RZhang YFu JJi GJiang F Soluble guanylate cyclase stimulators US Patent  US10030027 Publication Date 7/24/2018
More Info.:Get all data from this article,  Assay Method
 
Guanylate cyclase soluble subunit alpha-1
Name:Guanylate cyclase soluble subunit alpha-1
Synonyms:GCS-alpha-1 | GCS-alpha-3 | GUC1A3 | GUCSA3 | GUCY1A1 | GUCY1A3 | Guanylate cyclase soluble (GCS-alpha-1) | Guanylate cyclase soluble subunit alpha-3 | Solube guanylate cyclase alpha-1 (sGC alpha-1) | Solube guanylate cyclase alpha-1 (sGCalpha) | soluble guanylate cyclase alpha-1 (sGC)
Type:Enzyme
Mol. Mass.:77457.21
Organism:Homo sapiens (Human)
Description:Q02108
Residue:690
Sequence:
MFCTKLKDLKITGECPFSLLAPGQVPNESSEEAAGSSESCKATVPICQDIPEKNIQESLP
QRKTSRSRVYLHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAE
QAVAAGVPVEVIKESLGEEVFKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSHCQEAG
KRGRLEDASILCLDKEDDFLHVYYFFPKRTTSLILPGIIKAAAHVLYETEVEVSLMPPCF
HNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQ
FGNGIRRLMNRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRVRRWDNSVKKS
SRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR
AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNV
TMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHK
ESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNN
VTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAY
QQGTNSKPCFQKKDVEDGNANFLGKASGID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM280965
n/a
NameBDBM280965
Synonyms:(S)-4-amino-2- [1-(2-fluoro- benzyl)-1H- pyrazolo[3,4-b] pyridin-3-yl]- 5-methyl-5-{4- [2-(2H-tetrazol- 5-yl)ethyl] phenyl}-5,7- dihydro-6H- pyrrolo[2,3-d] pyrimidin-6-one | US10030027, Example 240B
TypeSmall organic molecule
Emp. Form.C29H24FN11O
Mol. Mass.561.5724
SMILESC[C@]1(C(=O)Nc2nc(nc(N)c12)-c1nn(Cc2ccccc2F)c2ncccc12)c1ccc(CCc2nn[nH]n2)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: