Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGuanylate cyclase soluble subunit alpha-1
LigandBDBM280986
Substrate/Competitorn/a
Meas. Tech.sGC Binding Assay
pH7.4±n/a
Ki 0.074±n/a nM
Commentsextracted
Citation Berger RChen YLi GGarfunkle JLi HMiao SRaghavan SSmith CJStelmach JWhitehead AZhang RZhang YFu JJi GJiang F Soluble guanylate cyclase stimulators US Patent  US10030027 Publication Date 7/24/2018
More Info.:Get all data from this article,  Assay Method
 
Guanylate cyclase soluble subunit alpha-1
Name:Guanylate cyclase soluble subunit alpha-1
Synonyms:GCS-alpha-1 | GCS-alpha-3 | GUC1A3 | GUCSA3 | GUCY1A1 | GUCY1A3 | Guanylate cyclase soluble (GCS-alpha-1) | Guanylate cyclase soluble subunit alpha-3 | Solube guanylate cyclase alpha-1 (sGC alpha-1) | Solube guanylate cyclase alpha-1 (sGCalpha) | soluble guanylate cyclase alpha-1 (sGC)
Type:Enzyme
Mol. Mass.:77457.21
Organism:Homo sapiens (Human)
Description:Q02108
Residue:690
Sequence:
MFCTKLKDLKITGECPFSLLAPGQVPNESSEEAAGSSESCKATVPICQDIPEKNIQESLP
QRKTSRSRVYLHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAE
QAVAAGVPVEVIKESLGEEVFKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSHCQEAG
KRGRLEDASILCLDKEDDFLHVYYFFPKRTTSLILPGIIKAAAHVLYETEVEVSLMPPCF
HNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQ
FGNGIRRLMNRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRVRRWDNSVKKS
SRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR
AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNV
TMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHK
ESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNN
VTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAY
QQGTNSKPCFQKKDVEDGNANFLGKASGID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM280986
n/a
NameBDBM280986
Synonyms:3-[1-{4-Amino-2-[6-chloro-1-(2-fluorobenzyl)-1H-indazol-3-yl]-5-methyl-6-oxo-6,7-dihydro-5H-pyrrolo[2,3-d]pyrimidin-5-yl}pyrrolidin-3-yl]propanoic acid | US10030027, Example 261C | US10030027, Example 261D
TypeSmall organic molecule
Emp. Form.C28H27ClFN7O3
Mol. Mass.564.01
SMILESCC1(N2CCC(CCC(O)=O)C2)C(=O)Nc2nc(nc(N)c12)-c1nn(Cc2ccccc2F)c2cc(Cl)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: