Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 1
LigandBDBM103302
Substrate/Competitorn/a
Meas. Tech.IMAP Assay
IC50 0.8±0.0 nM
Citation Cooper ABDeng YShipps, Jr. GWShih NZhu HYSun RKelly JMDoll RJNan YWang TDesai JAWang JJDong YMadison VSXiao LHruza AWSiddiqui MASamatar AAPaliwal STsui HCelebi AAWu YBoga SBAlhassan AGao XZhu LPatel M Compounds that are ERK inhibitors US Patent  US8546404 Publication Date 10/1/2013
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 1
Name:Mitogen-activated protein kinase 1
Synonyms:ERT1 | Extracellular signal-regulated kinase 2 | Extracellular signal-regulated kinase 2 (ERK2) | MAP kinase 1 | MAP kinase 2 | MAP kinase ERK2 | MAPK 1 | MAPK 2 | Mitogen-activated protein kinase 2 | p42 | p42-MAPK
Type:Protein
Mol. Mass.:41278.65
Organism:Mus musculus (Mouse)
Description:P63085
Residue:358
Sequence:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQ
TYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLS
NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG
ILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRI
EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM103302
n/a
NameBDBM103302
Synonyms:SCH772984 | US8546404, 6
TypeSmall organic molecule
Emp. Form.C33H33N9O2
Mol. Mass.587.6742
SMILESO=C(CN1CC[C@@H](C1)C(=O)Nc1ccc2[nH]nc(-c3ccncc3)c2c1)N1CCN(CC1)c1ccc(cc1)-c1ncccn1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: