Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcitonin gene-related peptide type 1 receptor
LigandBDBM103495
Substrate/Competitorn/a
Meas. Tech.Native Receptor Binding Assay
pH7.4±0
Ki 0.041±0.0 nM
Citation Wood MRKim JJSelnick HGStachel SJ Non-amidic linkers with branched termini as CGRP receptor antagonists US Patent  US8552023 Publication Date 10/8/2013
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Calcitonin gene-related peptide type 1 receptor
Name:Adrenomedullin receptor AM1; CALCRL/RAMP2
Synonyms:Calcitonin gene-related peptide (CGRP) receptor | Calcitonin gene-related peptide 1 (CGRP) | Calcitonin receptor-like receptor
Type:Enzyme
Mol. Mass.:52931.38
Organism:Homo sapiens (Human)
Description:Q16602
Residue:461
Sequence:
MEKKCTLNFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQA
EGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRT
WTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNL
FFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTL
IVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICA
ALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKI
AEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSAS
YTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM103495
n/a
NameBDBM103495
Synonyms:US8552023, 7
TypeSmall organic molecule
Emp. Form.C30H29F3N4O2
Mol. Mass.534.5721
SMILESC[C@@H](N(C\C=C\c1cnc2C[C@]3(Cc2c1)C(=O)Nc1ncccc31)C(=O)C(C)(C)CF)c1cc(F)cc(F)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: