Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 1
LigandBDBM50248476
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
IC50 52± 0 nM
Citation Chen DSong HYSun ETYu NZou Y Benzimidazole derivatives: preparation and pharmaceutical applications US Patent  US8551988 Publication Date 10/8/2013
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 1
Name:Histone deacetylase 1/6
Synonyms:HD1 | Histone deacetylase 1 (HDAC1) | Human HDAC1 | RPD3L1
Type:Enzyme
Mol. Mass.:55090.27
Organism:Homo sapiens (Human)
Description:Purified from NIH 3T3 cells harboring human HDAC1 using an anti-FLAG M2 antibody.
Residue:482
Sequence:
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50248476
n/a
NameBDBM50248476
Synonyms:CHEMBL491316 | N-hydroxy-3-(2-phenethyl-1-(2-(pyrrolidin-1-yl)ethyl)-1H-benzo[d]imidazol-5-yl)acrylamide | N-hydroxy-3-[2-phenethyl-1-(2-pyrrolidin-1-ylethyl)-1H-benzimidazol-5-yl]acrylamide | SB-639 | US10201527, Compound 72 | US8551988, 72
TypeSmall organic molecule
Emp. Form.C24H28N4O2
Mol. Mass.404.5047
SMILESONC(=O)\C=C\c1ccc2n(CCN3CCCC3)c(CCc3ccccc3)nc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: