Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone Lysine Demethylase
LigandBDBM50193145
Substrate/Competitorn/a
Meas. Tech.In vitro Hydroxylation Assays for PHD2 (AlphaScreen)
pH7.5±0
IC50>2.0e+4± 0 nM
Citation Chowdhury RCandela-Lena JIChan MCGreenald DJYeoh KKTian YMMcDonough MATumber ARose NRConejo-Garcia ADemetriades MMathavan SKawamura ALee MKvan Eeden FPugh CWRatcliffe PJSchofield CJ Selective Small Molecule Probes for the Hypoxia Inducible Factor (HIF) Prolyl Hydroxylases. ACS Chem Biol 8:1488-96 (2013) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Histone Lysine Demethylase
Name:Histone Lysine Demethylase
Synonyms:2-OG-Dependent Histone Demethylase JMJD2E | Jumonji domain-containing protein 2E (JMJD2E) | KDM4D-like protein | Lysine-specific demethylase 4D-like | Lysine-specific demethylase 4E | Lysine-specific demethylase 4E (KDM4E)
Type:Enzyme
Mol. Mass.:56815.71
Organism:Homo sapiens (Human)
Description:B2RXH2
Residue:506
Sequence:
MKSVHSSPQNTSHTIMTFYPTMEEFADFNTYVAYMESQGAHQAGLAKVIPPKEWKARQMY
DDIEDILIATPLQQVTSGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQTPPHQNFADLEQ
RYWKSHPGNPPIYGADISGSLFEESTKQWNLGHLGTILDLLEQECGVVIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKTWYVVPPEHGQHLERLARELFPDISRGCEAFLR
HKVALISPTVLKENGIPFNCMTQEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRWIDY
GKMASQCSCGESTVTFSMDPFVRIVQPESYELWKHRQDLAIVEHTEPRVAESQELSNWRD
DIVLRRAALGLRLLPNLTAQCPTQPVSSGHCYNPKGCGTDAVPGSAFQSSAYHTQTQSLT
LGMSARVLLPSTGSWGSGRGRGRGQGQGRGCSRGRGHGCCTRELGTEEPTVQPASKRRLL
MGTRSRAQGHRPQLPLANDLMTNLSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50193145
n/a
NameBDBM50193145
Synonyms:2-(1-chloro-4-hydroxyisoquinoline-3-carboxamido)acetic acid | CHEMBL426560 | Isoquinoline 3 | N-[(1-CHLORO-4-HYDROXYISOQUINOLIN-3-YL)CARBONYL]GLYCINE
TypeSmall organic molecule
Emp. Form.C12H9ClN2O4
Mol. Mass.280.664
SMILESOC(=O)CNC(=O)c1nc(Cl)c2ccccc2c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: