Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHomo sapiens lysine demethylase 2A (KDM2A)
LigandBDBM103845
Substrate/Competitorn/a
Meas. Tech.In vitro Hydroxylation Assays for PHD2 (AlphaScreen)
pH7.5±0
IC50>1.00e+5± 0 nM
Citation Chowdhury RCandela-Lena JIChan MCGreenald DJYeoh KKTian YMMcDonough MATumber ARose NRConejo-Garcia ADemetriades MMathavan SKawamura ALee MKvan Eeden FPugh CWRatcliffe PJSchofield CJ Selective Small Molecule Probes for the Hypoxia Inducible Factor (HIF) Prolyl Hydroxylases. ACS Chem Biol 8:1488-96 (2013) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Homo sapiens lysine demethylase 2A (KDM2A)
Name:Homo sapiens lysine demethylase 2A (KDM2A)
Synonyms:AA1-1162 | F-box and leucine-rich repeat protein 11 | FBXL11 | Lysine-specific demethylase 2A | Lysine-specific demethylase 2A (KDM2A) | NM_012308
Type:Enzyme Catalytic Domain
Mol. Mass.:132809.04
Organism:Homo sapiens (Human)
Description:n/a
Residue:1162
Sequence:
MEPEEERIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGK
DFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIE
MTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKES
QTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHN
LELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFL
HSFNIPMQLKIYNIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKEFQKESLS
MDLELNGLESGNGDEEAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKT
LAGDSSSDCSRGSHNGQVWDPQCAPRKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPT
GIEDEDALIADVKILLEELANSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKP
HTMKPAPRLTPVRPAAASPIVSGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRM
KQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEG
LLNEELPNCWECPKCYQEDSSEKAQKRKMEESDEEAVQAKVLRPLRSCDEPLTPPPHSPT
SMLQLIHDPVSPRGMVTRSSPGAGPSDHHSASRDERFKRRQLLRLQATERTMVREKENNP
SGKKELSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQAITASSANLRHSPRVLVQHC
PARTPQRGDEEGLGGEEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESWMQREVWMS
VFRYLSRRELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLS
WTNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIR
DLLTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQ
SSNLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIANVTLIDLRGCKQITRKACEHF
ISDLSINSLYCLSDEKLIQKIS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM103845
n/a
NameBDBM103845
Synonyms:4HQ derivative 8
TypeSmall organic molecule
Emp. Form.C19H24N2O4
Mol. Mass.344.4049
SMILESCCCCCCCc1nc(C(=O)NCC(O)=O)c(O)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: