Reaction Details |
| Report a problem with these data |
Target | Fucose-binding lectin PA-IIL |
---|
Ligand | BDBM103981 |
---|
Substrate/Competitor | n/a |
---|
IC50 | 1.578e+5± 5.28e+4 nM |
---|
Kd | 7.1e+4±n/a nM |
---|
Citation | Hauck, D; Joachim, I; Frommeyer, B; Varrot, A; Philipp, B; Möller, HM; Möller, A; Exner, TE; Titz, A Discovery of two classes of potent glycomimetic inhibitors of Pseudomonas aeruginosa LecB with distinct binding modes. ACS Chem Biol8:1775-84 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Fucose-binding lectin PA-IIL |
---|
Name: | Fucose-binding lectin PA-IIL |
Synonyms: | LecB | PA-IIL |
Type: | Protein |
Mol. Mass.: | 11857.84 |
Organism: | Pseudomonas aeruginosa |
Description: | Q9HYN5 |
Residue: | 115 |
Sequence: | MATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGS
SGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
|
|
|
BDBM103981 |
---|
n/a |
---|
Name | BDBM103981 |
Synonyms: | LecB Inhibitor Compound 1 |
Type | Small organic molecule |
Emp. Form. | C7H14O6 |
Mol. Mass. | 194.1825 |
SMILES | COC1O[C@H](CO)[C@@H](O)C(O)[C@@H]1O |r| |
Structure |
|