| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fucose-binding lectin PA-IIL |
|---|
| Ligand | BDBM103986 |
|---|
| Substrate/Competitor | n/a |
|---|
| IC50 | 2.794e+5± 1.202e+5 nM |
|---|
| Citation |  Hauck, D; Joachim, I; Frommeyer, B; Varrot, A; Philipp, B; Möller, HM; Möller, A; Exner, TE; Titz, A Discovery of two classes of potent glycomimetic inhibitors of Pseudomonas aeruginosa LecB with distinct binding modes. ACS Chem Biol8:1775-84 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Fucose-binding lectin PA-IIL |
|---|
| Name: | Fucose-binding lectin PA-IIL |
|---|
| Synonyms: | LecB | PA-IIL |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 11857.84 |
|---|
| Organism: | Pseudomonas aeruginosa |
|---|
| Description: | Q9HYN5 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGS
SGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
|
|
|
|---|
| BDBM103986 |
|---|
| n/a |
|---|
| Name | BDBM103986 |
|---|
| Synonyms: | LecB Inhibitor Triazoles 2d |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H21N3O5 |
|---|
| Mol. Mass. | 335.355 |
|---|
| SMILES | COC1O[C@H](Cn2cc(nn2)-c2cccc(C)c2)[C@@H](O)C(O)[C@@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
