Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEpithelial discoidin domain-containing receptor 1
LigandBDBM104009
Substrate/Competitorn/a
Meas. Tech.Enzyme Kinase Assay
EC50 86± 0 nM
Citation Kim HGTan LWeisberg ELLiu FCanning PChoi HGEzell SAWu HZhao ZWang JMandinova AGriffin JDBullock ANLiu QLee SWGray NS Discovery of a potent and selective DDR1 receptor tyrosine kinase inhibitor. ACS Chem Biol 8:2145-50 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Epithelial discoidin domain-containing receptor 1
Name:Epithelial discoidin domain-containing receptor 1
Synonyms:Discoidin domain receptor 1 (DDR1) | Discoidin domain-containing receptor 1 (DDR1) | Discoidin receptor tyrosine kinase | Epithelial discoidin domain receptor 1 | Epithelial discoidin domain receptor 1 (DDR1) | HGK2 | Mammary carcinoma kinase 10 | Protein-tyrosine kinase RTK 6 | Tyrosine-protein kinase CAK
Type:Tyrosine-protein kinase
Mol. Mass.:101130.02
Organism:Homo sapiens (Human)
Description:Q08345
Residue:913
Sequence:
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR
HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL
RYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRV
ELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDD
FRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG
VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFS
EISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI
GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPRE
PPPYQEPRPRGNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNT
QAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGP
PRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPD
ATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLED
KAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTI
KIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC
RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQ
LHRFLAEDALNTV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM104009
n/a
NameBDBM104009
Synonyms:DDR1-IN-1
TypeSmall organic molecule
Emp. Form.C30H31F3N4O3
Mol. Mass.552.5873
SMILESCCN1CCN(Cc2ccc(cc2C(F)(F)F)C(=O)Nc2ccc(C)c(Oc3ccc4NC(=O)Cc4c3)c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: