| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-2 |
|---|
| Ligand | BDBM104065 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Kinome Profiling |
|---|
| IC50 | 18000±0.0 nM |
|---|
| Citation |  Carlson, DA; Franke, AS; Weitzel, DH; Speer, BL; Hughes, PF; Hagerty, L; Fortner, CN; Veal, JM; Barta, TE; Zieba, BJ; Somlyo, AV; Sutherland, C; Deng, JT; Walsh, MP; Macdonald, JA; Haystead, TA Fluorescence Linked Enzyme Chemoproteomic Strategy for Discovery of a Potent and Selective DAPK1 and ZIPK Inhibitor. ACS Chem Biol8:2715-23 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-2 |
|---|
| Name: | Serine/threonine-protein kinase pim-2 |
|---|
| Synonyms: | PIM2 | PIM2_HUMAN | Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase pim-2 (PIM2) |
|---|
| Type: | Serine/threonine-protein kinase |
|---|
| Mol. Mass.: | 34185.93 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9P1W9 |
|---|
| Residue: | 311 |
|---|
| Sequence: | MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
|
|
|
|---|
| BDBM104065 |
|---|
| n/a |
|---|
| Name | BDBM104065 |
|---|
| Synonyms: | HS38 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H12ClN5O2S |
|---|
| Mol. Mass. | 349.795 |
|---|
| SMILES | CC(Sc1nc2n(ncc2c(=O)[nH]1)-c1cccc(Cl)c1)C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
