Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV WT-A pol protein (wild-type clade A)
LigandBDBM104108
Substrate/Competitorn/a
Meas. Tech.Drug Susceptibility Assay
EC50 38.4±0.0 nM
Citation Shen YAltman MDAli ANalam MNCao HRana TMSchiffer CATidor B Testing the substrate-envelope hypothesis with designed pairs of compounds. ACS Chem Biol 8:2433-41 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HIV WT-A pol protein (wild-type clade A)
Name:HIV WT-A pol protein (wild-type clade A)
Synonyms:WT-A
Type:Protein
Mol. Mass.:45102.50
Organism:Human immunodeficiency virus
Description:n/a
Residue:397
Sequence:
PQITLWQRPLVTVKIGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQ
IIEICGKKAGTVLVGPTPVNIIGRNMLTQIGCTLNFPISPIETVPVTLKPGMDGPIKQWP
LTEEKIKALTEICKEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQ
DFWEVQLGIHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQY
NVLPQGWKGSPAIFQSSMIKILEPFRSQNPEIIIYQYMDDLYVGSDLEIGQHRAKVEELR
AHLLWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPDKDSWTVNDIQKLVGKLNWA
SQIYPGIKVKQLCRLLRGAKALTDVPLTEEAELELAE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM104108
n/a
NameBDBM104108
Synonyms:N-[(1S,2R)-3-[(Cyclohexylmethyl)[(4-methoxyphenyl)sulfonyl]amino]-2-hydroxy-1- (phenylmethyl)propyl]-3-hydroxy-benzamide (AF-77)
TypeSmall organic molecule
Emp. Form.C31H38N2O6S
Mol. Mass.566.708
SMILESCOc1ccc(cc1)S(=O)(=O)N(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)c1cccc(O)c1)CC1CCCCC1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: